PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta005181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 199aa    MW: 22111.7 Da    PI: 4.2687
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-96082554PU_refplantGDBView CDS
gnl|UG|Pta#S23009464PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26083.33.6e-2662153899
     DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                ++++C ++C+l   f++++ +kfa+++++FGa nv++l+++lp ++r +a++slv+eA ar+++P  G++g+i++lq+q++ l++++ ++++
  Pta005181  62 KQKECLENCTLLYQFASNDLHKFAILQQVFGACNVVRLVQDLPSDQRVEAIDSLVFEASARLENPAFGCTGIIHQLQRQVSDLQSQITTTQT 153
                4569**********************************************************************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.57754155IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-2462152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
LRDFFLQIIH CGFGFALIQM SNSAEKQPMG TDMDDSEFQK QKECSEKPLT GSDLDDDSKV  60
QKQKECLENC TLLYQFASND LHKFAILQQV FGACNVVRLV QDLPSDQRVE AIDSLVFEAS  120
ARLENPAFGC TGIIHQLQRQ VSDLQSQITT TQTTIEKIRS QQAVLLASLA GFNAPGEDGN  180
KFKPTTSASP KDDDDQDED
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.195870.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U31e-56A9P1U3_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-26LOB domain-containing protein 1